PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000140229
Common NameNAC12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 419aa    MW: 48166.5 Da    PI: 6.5078
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000140229genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.1e-51161451129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPt+eel+++yL+kkv+ ++++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++
  MDP0000140229  16 VPPGFRFHPTEEELLHYYLRKKVAFERIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKIIY 110
                    69****************************.9***************964444222455************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    s + + +gl+ktLvfykgrap+g+k+dW+mheyrle
  MDP0000140229 111 S-GFKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRLE 145
                    *.9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-559154IPR003441NAC domain
PROSITE profilePS5100554.90316194IPR003441NAC domain
PfamPF023651.7E-2617144IPR003441NAC domain
SuperFamilySSF1019413.4E-55182194IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MSDDHMSLSI NGQSQVPPGF RFHPTEEELL HYYLRKKVAF ERIDLDVIRE VDLNKLEPWD  60
IQEKCKIGST PQNDWYFFSH KDKKYPTGTR TNRATTAGFW KATGRDKIIY SGFKRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLEESNST HDTTNDLSLN LTRSWKQGHS VTVSSSMGES  180
MTEEGWVVCR VFKKKNYQKA LESPKASFSM DSSNNQIHGS RNDGVLDQIL MYMGRTCKLE  240
NHDEPLTMNN ISERFMHLPR LESPTLPNLP AFDQDRSFKA CYQAIDDMFI ETEPPSTNQQ  300
SNGCDNNELV DDHEDPKRRV NDWVTLDRLV ASQLGQLNGQ DQVTPKHLSC FGDPNMAFCS  360
SPPPRNDHDH DVQLSYPYLR TSSSSHHQSD VYNNENDLWN FTKSSSSPSS TDPLCHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-471219611170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.168600.0bud| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280877.10.0NAC domain-containing protein 43-like
SwissprotQ84WP61e-118NAC43_ARATH; NAC domain-containing protein 43
TrEMBLD9ZJ900.0D9ZJ90_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s15640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-103NAC family protein